View larger
Human SRD5A2 full-length ORF (ADR82875.1) recombinant protein without tag.<br>This product is belong to Proteoliposome (PL).
AB-H00006716-G01
New product
SRD5A2 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 5 pontos de fidelização. Seu carrinho totalizará 5 pontos de fidelização que podem ser convertidos num vale de desconto de 20.00EUR.
Data sheet
| Size | 10 ug |
| Gene Name | SRD5A2 |
| Gene Alias | MGC138457 |
| Gene Description | steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2) |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Application Key | AP |
| Immunogen Prot. Seq | MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPAGILARQPLSLFGPPGTVLLGLFCLHYFHRTFVYSLLNRGRPYPAILILRGTAFCTGNGVLQGYYLIYCAEYPDGWYTDIRFSLGVFLFILGMGINIHSDYILRQLRKPGEISYRIPQGGLFTYVSGANFLGEIIEWIGYALATWSLPALAFAFFSLCFLGLRAFHHHRFYLKMFEDYPKSRKALIPFIF |
| Form | Liquid |
| Recomended Dilution | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
| Antigen species Target species | Human |
| Storage Buffer | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene ID | 6716 |
More info
Human SRD5A2 full-length ORF (ADR82875.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
This product is belong to Proteoliposome (PL).