SLC14A1 (Human) Recombinant Protein
  • SLC14A1 (Human) Recombinant Protein

SLC14A1 (Human) Recombinant Protein

Ref: AB-H00006563-G01
SLC14A1 (Human) Recombinant Protein

Información del producto

Human SLC14A1 full-length ORF (NP_001012527.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name SLC14A1
Gene Alias FLJ33745|FLJ41687|HUT11|HsT1341|JK|RACH1|UT-B1|UT1|UTE
Gene Description solute carrier family 14 (urea transporter), member 1 (Kidd blood group)
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MEDSPTMVRVDSPTMVRGENQVSPCQGRRCFPKALGYVTGDMKELANQLKDKPVVLQFIDWILRGISQVVFVNNPVSGILILVGLLVQNPWWALTGWLGTVVSTLMALLLSQDRSLIASGLYGYNATLVGVLMAVFSDKGDYFWWLLLPVCAMSMTCPIFSSALNSVLSKWDLPVFTLPFNMALSMYLSATGHYNPFFPAKLVIPITTAPNISWSDLSALELLKSIPVGVGQIYGCDNPWTGGIFLGAILLSSPL
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 6563

Enviar uma mensagem


SLC14A1 (Human) Recombinant Protein

SLC14A1 (Human) Recombinant Protein