SLC6A8 (Human) Recombinant Protein (P01)
  • SLC6A8 (Human) Recombinant Protein (P01)

SLC6A8 (Human) Recombinant Protein (P01)

Ref: AB-H00006535-P01
SLC6A8 (Human) Recombinant Protein (P01)

Información del producto

Human SLC6A8 full-length ORF ( AAH81558.1, 1 a.a. - 635 a.a.) recombinant protein with GST-tag at N-terminal.
Información adicional
Size 2 ug
Gene Name SLC6A8
Gene Alias CRT|CRTR|CT1|MGC87396
Gene Description solute carrier family 6 (neurotransmitter transporter, creatine), member 8
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MAKKSAENGIYSVSGDEKKGPLIAPGPDGAPAKGDGPVGLGTPGGRLAVPPRETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLIALVGGIPIFFLEISLGQFMKAGSINVWNICPLFKGLGYASMVIVFYCNTYYIMVLAWGFYYLVKSFTTTLPWATCGHTWNTPDCVEIFRHEDCANASLANLTCDQLADRRSPVIEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFCVWKGVK
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 6535

Enviar uma mensagem


SLC6A8 (Human) Recombinant Protein (P01)

SLC6A8 (Human) Recombinant Protein (P01)