SLC6A8 (Human) Recombinant Protein
  • SLC6A8 (Human) Recombinant Protein

SLC6A8 (Human) Recombinant Protein

Ref: AB-H00006535-G01
SLC6A8 (Human) Recombinant Protein

Información del producto

Human SLC6A8 full-length ORF (AAH81558.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name SLC6A8
Gene Alias CRT|CRTR|CT1|MGC87396
Gene Description solute carrier family 6 (neurotransmitter transporter, creatine), member 8
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MAKKSAENGIYSVSGDEKKGPLIAPGPDGAPAKGDGPVGLGTPGGRLAVPPRETWTRQMDFIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYVLIALVGGIPIFFLEISLGQFMKAGSINVWNICPLFKGLGYASMVIVFYCNTYYIMVLAWGFYYLVKSFTTTLPWATCGHTWNTPDCVEIFRHEDCANASLANLTCDQLADRRSPVIEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFCVWKGVK
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 6535

Enviar uma mensagem


SLC6A8 (Human) Recombinant Protein

SLC6A8 (Human) Recombinant Protein