SCTR (Human) Recombinant Protein
  • SCTR (Human) Recombinant Protein

SCTR (Human) Recombinant Protein

Ref: AB-H00006344-G01
SCTR (Human) Recombinant Protein

Información del producto

Human SCTR full-length ORF (AAH35757.2) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name SCTR
Gene Alias SR
Gene Description secretin receptor
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MRPHLSPPLQQLLLPVLLACAAHSTGALPRLCDVLQVLWEEQDQCLQELSREQTGDLGTEQPVPGCEGMWDNISCWPSSVPGRMVEVECPRFLRMLTSRNGSLFRNCTQDGWSETFPRPNLACGVNVNDSSNEKRHSYLLKLKVMYTVGYSSSLVMLLVALGILCAFRRLHCTRNYIHMHLFVSFILRALSNFIKDAVLFSSDDVTYCDAHRAGCKLIMVLFQYCIMANYSWLLVEGLYLHTLLAISFFSERKYL
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 6344

Enviar uma mensagem


SCTR (Human) Recombinant Protein

SCTR (Human) Recombinant Protein