PTGER2 (Human) Recombinant Protein
  • PTGER2 (Human) Recombinant Protein

PTGER2 (Human) Recombinant Protein

Ref: AB-H00005732-G01
PTGER2 (Human) Recombinant Protein

Información del producto

Human PTGER2 full-length ORF (NP_000947.2) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name PTGER2
Gene Alias EP2
Gene Description prostaglandin E receptor 2 (subtype EP2), 53kDa
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGRRSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFSLATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQYCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGSGRGGPGARRRGERVS
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 5732

Enviar uma mensagem


PTGER2 (Human) Recombinant Protein

PTGER2 (Human) Recombinant Protein