PTAFR (Human) Recombinant Protein
  • PTAFR (Human) Recombinant Protein

PTAFR (Human) Recombinant Protein

Ref: AB-H00005724-G01
PTAFR (Human) Recombinant Protein

Información del producto

Human PTAFR full-length ORF (ACE87813.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name PTAFR
Gene Alias PAFR
Gene Description platelet-activating factor receptor
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MEPHDSSHMDSEFRYTLFPIVYSIIFVLGVIANGYVLWVFARLYPCKKFNEIKIFMVNLTMADMLFLITLPLWIVYYQNQGNWILPKFLCNVAGCLFFINTYCSVAFLGVITYNRFQAVTRPIKTAQANTRKRGISLSLVIWVAIVGAASYFLILDSTNTVPDSAGSGNVTRCFEHYEKGSVPVLIIHIFIVFSFFLVFLIILFCNLVIIRTLLMQPVQQQRNAEVKRRALWMVCTVLAVFIICFVPHHVVQLPW
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 5724

Enviar uma mensagem


PTAFR (Human) Recombinant Protein

PTAFR (Human) Recombinant Protein