PPYR1 (Human) Recombinant Protein
  • PPYR1 (Human) Recombinant Protein

PPYR1 (Human) Recombinant Protein

Ref: AB-H00005540-G01
PPYR1 (Human) Recombinant Protein

Información del producto

Human PPYR1 full-length ORF (ENSP00000363431) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name PPYR1
Gene Alias MGC116897|NPY4-R|NPY4R|PP1|Y4
Gene Description pancreatic polypeptide receptor 1
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MNTSHLLALLLPKSPQGENRSKPLGTPYNFSEHCQDSVDVMVFIVTSYSIETVVGVLGNLCLMCVTVRQKEKANVTNLLIANLAFSDFLMCLLCQPLTAVYTIMDYWIFGETLCKMSAFIQCMSVTVSILSLVLVALERHQLIINPTGWKPSISQAYLGIVLIWVIACVLSLPFLANSILENVFHKNHSKALEFLADKVVCTESWPLAHHRTIYTTFLLLFQYCLPLGFILVCYARIYRRLQRQGRVFHKGTYSL
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 5540

Enviar uma mensagem


PPYR1 (Human) Recombinant Protein

PPYR1 (Human) Recombinant Protein