OPRM1 (Human) Recombinant Protein
  • OPRM1 (Human) Recombinant Protein

OPRM1 (Human) Recombinant Protein

Ref: AB-H00004988-G01
OPRM1 (Human) Recombinant Protein

Información del producto

Human OPRM1 full-length ORF (NP_000905.3) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name OPRM1
Gene Alias KIAA0403|MOR|MOR1|OPRM
Gene Description opioid receptor, mu 1
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MDSSAAPTNASNCTDALAYSSCSPAPSPGSWVNLSHLDGNLSDPCGPNRTDLGGRDSLCPPTGSPSMITAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIINVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYG
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 4988

Enviar uma mensagem


OPRM1 (Human) Recombinant Protein

OPRM1 (Human) Recombinant Protein