NCAM1 (Human) Recombinant Protein
  • NCAM1 (Human) Recombinant Protein

NCAM1 (Human) Recombinant Protein

Ref: AB-H00004684-G01
NCAM1 (Human) Recombinant Protein

Información del producto

Human NCAM1 full-length ORF (AAH47244.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name NCAM1
Gene Alias CD56|MSK39|NCAM
Gene Description neural cell adhesion molecule 1
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MLQTKDLIWTLFFLGTAVSLQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGEKLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKLMFKNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGFPEPTMSWTKDGEQIE
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 4684

Enviar uma mensagem


NCAM1 (Human) Recombinant Protein

NCAM1 (Human) Recombinant Protein