CD46 (Human) Recombinant Protein
  • CD46 (Human) Recombinant Protein

CD46 (Human) Recombinant Protein

Ref: AB-H00004179-G01
CD46 (Human) Recombinant Protein

Información del producto

Human CD46 full-length ORF (NP_722548.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name CD46
Gene Alias MCP|MGC26544|MIC10|TLX|TRA2.10
Gene Description CD46 molecule, complement regulatory protein
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MEPPGRRECPFPSWRFPGLLLAAMVLLLYSFSDACEEPPTFEAMELIGKPKPYYEIGERVDYKCKKGYFYIPPLATHTICDRNHTWLPVSDDACYRETCPYIRDPLNGQAVPANGTYEFGYQMHFICNEGYYLIGEEILYCELKGSVAIWSGKPPICEKVLCTPPPKIKNGKHTFSEVEVFEYLDAVTYSCDPAPGPDPFSLIGESTIYCGDNSVWSRAAPECKVVKCRFPVVENGKQISGFGKKFYYKATVMFE
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 4179

Enviar uma mensagem


CD46 (Human) Recombinant Protein

CD46 (Human) Recombinant Protein