EPCAM (Human) Recombinant Protein
  • EPCAM (Human) Recombinant Protein

EPCAM (Human) Recombinant Protein

Ref: AB-H00004072-H03
EPCAM (Human) Recombinant Protein

Información del producto

Purified EPCAM (NP_002345.1 24 a.a. - 265 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
Información adicional
Size 25 ug
Gene Name EPCAM
Gene Alias 17-1A|323/A3|CD326|CO-17A|CO17-1A|EGP|EGP-2|EGP34|EGP40|ESA|Ep-CAM|GA733-2|HEA125|KS1/4|KSA|M4S1|MH99|MIC18|MK-1|MOC31|TACST-1|TACSTD1|TROP1|hEGP-2
Gene Description epithelial cell adhesion molecule
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Concentration >= 10 ug/ml
Application Key WB,ELISA,SDS-PAGE,PI
Immunogen Prot. Seq QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK
Form Liquid
Antigen species Target species Human
Quality control testing SDS-PAGE and Western Blot
Storage Buffer In PBS.
Host Human HEK293H cells
Gene ID 4072

Enviar uma mensagem


EPCAM (Human) Recombinant Protein

EPCAM (Human) Recombinant Protein