View larger
Purified LTA (AAH34729.1 58 a.a. - 205 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in huma
AB-H00004049-H02
New product
LTA (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 8 pontos de fidelização. Seu carrinho totalizará 8 pontos de fidelização que podem ser convertidos num vale de desconto de 32.00EUR.
Data sheet
| Size | 25 ug |
| Gene Name | LTA |
| Gene Alias | LT|TNFB|TNFSF1 |
| Gene Description | lymphotoxin alpha (TNF superfamily, member 1) |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Concentration | >= 10 ug/ml |
| Application Key | WB,ELISA,SDS-PAGE,PI |
| Immunogen Prot. Seq | HSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | SDS-PAGE and Western Blot |
| Storage Buffer | 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin. |
| Host | Human HEK293H cells |
| Gene ID | 4049 |
More info
Purified LTA (AAH34729.1 58 a.a. - 205 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.