KCND3 (Human) Recombinant Protein
  • KCND3 (Human) Recombinant Protein

KCND3 (Human) Recombinant Protein

Ref: AB-H00003752-G01
KCND3 (Human) Recombinant Protein

Información del producto

Human KCND3 full-length ORF (ADR83090.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name KCND3
Gene Alias KCND3L|KCND3S|KSHIVB|KV4.3|MGC142035|MGC142037
Gene Description potassium voltage-gated channel, Shal-related subfamily, member 3
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MAAGVAAWLPFARAAAIGWMPVANCPMPLAPADKNKRQDELIVLNVSGRRFQTWRTTLERYPDTLLGSTEKEFFFNEDTKEYFFDRDPEVFRCVLNFYRTGKLHYPRYECISAYDDELAFYGILPEIIGDCCYEEYKDRKRENAERLMDDNDSENNQESMPSLSFRQTMWRAFENPHTSTLALVFYYVTGFFIAVSVITNVVETVPCGTVPGSKELPCGERYSVAFFCLDTACVMIFTVEYLLRLFAAPSRYRFI
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 3752

Enviar uma mensagem


KCND3 (Human) Recombinant Protein

KCND3 (Human) Recombinant Protein