ITGB2 (Human) Recombinant Protein
  • ITGB2 (Human) Recombinant Protein

ITGB2 (Human) Recombinant Protein

Ref: AB-H00003689-G01
ITGB2 (Human) Recombinant Protein

Información del producto

Human ITGB2 full-length ORF (AAH05861.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name ITGB2
Gene Alias CD18|LAD|LCAMB|LFA-1|MAC-1|MF17|MFI7
Gene Description integrin, beta 2 (complement component 3 receptor 3 and 4 subunit)
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MLGLRPPLLALVGLLSLGCVLSQECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLDDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFVNTHPDKLRNPCPNKEKECQPPFAFRHVLKLTNNSNQFQTEVGKQLISGNLDAPEGGLDAMMQVAACPEEIGWRNV
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 3689

Enviar uma mensagem


ITGB2 (Human) Recombinant Protein

ITGB2 (Human) Recombinant Protein