CXCR1 (Human) Recombinant Protein (P01)
  • CXCR1 (Human) Recombinant Protein (P01)

CXCR1 (Human) Recombinant Protein (P01)

Ref: AB-H00003577-P01
CXCR1 (Human) Recombinant Protein (P01)

Información del producto

Human CXCR1 full-length ORF ( AAH28221.1, 1 a.a. - 350 a.a.) recombinant protein with GST-tag at N-terminal.
Información adicional
Size 2 ug
Gene Name CXCR1
Gene Alias C-C|C-C-CKR-1|CD128|CD181|CDw128a|CKR-1|CMKAR1|IL8R1|IL8RA|IL8RBA
Gene Description chemokine (C-X-C motif) receptor 1
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MSNITDPQMWDFDDLNFTGMPPADEDYSPCRLETETLNKYVVIIAYALVFLLSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRHLVKFVCLGCWGLSMNLSLPFFLFRQAYHPNNSSPVCYEVLGNDTAKWRMVLRILPHTFGFIVPLFVMLFCYGFTLRTLFKAHMGQKHRAMRVIFAVVLIFLLCW
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 3577

Enviar uma mensagem


CXCR1 (Human) Recombinant Protein (P01)

CXCR1 (Human) Recombinant Protein (P01)