IL3RA (Human) Recombinant Protein
  • IL3RA (Human) Recombinant Protein

IL3RA (Human) Recombinant Protein

Ref: AB-H00003563-H01
IL3RA (Human) Recombinant Protein

Información del producto

Purified IL3RA (NP_002174.1, 19 a.a. - 305 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
Información adicional
Size 25 ug
Gene Name IL3RA
Gene Alias CD123|IL3R|IL3RAY|IL3RX|IL3RY|MGC34174|hIL-3Ra
Gene Description interleukin 3 receptor, alpha (low affinity)
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Concentration &ge
Application Key WB,ELISA,SDS-PAGE,PI
Immunogen Prot. Seq TKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIR
Form Liquid
Antigen species Target species Human
Quality control testing SDS-PAGE and Western Blot
Storage Buffer 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Host Human HEK293H cells
Gene ID 3563

Enviar uma mensagem


IL3RA (Human) Recombinant Protein

IL3RA (Human) Recombinant Protein