IL3RA (Human) Recombinant Protein
  • IL3RA (Human) Recombinant Protein

IL3RA (Human) Recombinant Protein

Ref: AB-H00003563-G01
IL3RA (Human) Recombinant Protein

Información del producto

Human IL3RA full-length ORF (NP_002174.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name IL3RA
Gene Alias CD123|IL3R|IL3RAY|IL3RX|IL3RY|MGC34174|hIL-3Ra
Gene Description interleukin 3 receptor, alpha (low affinity)
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVR
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 3563

Enviar uma mensagem


IL3RA (Human) Recombinant Protein

IL3RA (Human) Recombinant Protein