IL1R1 (Human) Recombinant Protein
  • IL1R1 (Human) Recombinant Protein

IL1R1 (Human) Recombinant Protein

Ref: AB-H00003554-G01
IL1R1 (Human) Recombinant Protein

Información del producto

Human IL1R1 full-length ORF (NP_000868.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name IL1R1
Gene Alias CD121A|D2S1473|IL-1R-alpha|IL1R|IL1RA|P80
Gene Description interleukin 1 receptor, type I
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MKVLLRLICFIALLISSLEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLS
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 3554

Enviar uma mensagem


IL1R1 (Human) Recombinant Protein

IL1R1 (Human) Recombinant Protein