IFNGR1 (Human) Recombinant Protein
  • IFNGR1 (Human) Recombinant Protein

IFNGR1 (Human) Recombinant Protein

Ref: AB-H00003459-G01
IFNGR1 (Human) Recombinant Protein

Información del producto

Human IFNGR1 full-length ORF (AAH05333.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name IFNGR1
Gene Alias CD119|FLJ45734|IFNGR
Gene Description interferon gamma receptor 1
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MALLFLLPLVMQGVSRAEMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKGSLWIPVVAAL
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 3459

Enviar uma mensagem


IFNGR1 (Human) Recombinant Protein

IFNGR1 (Human) Recombinant Protein