ICAM3 (Human) Recombinant Protein
  • ICAM3 (Human) Recombinant Protein

ICAM3 (Human) Recombinant Protein

Ref: AB-H00003385-G01
ICAM3 (Human) Recombinant Protein

Información del producto

Human ICAM3 full-length ORF (AAH58903.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name ICAM3
Gene Alias CD50|CDW50|ICAM-R
Gene Description intercellular adhesion molecule 3
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MATMVPSVLWPRACWTLLVCCLLTPGVQGQEFLLRVEPQNPVLSAGGSLFVNCSTDCPSSEKIALETSLSKELVASGMGWAAFNLSNVTGNSRILCSVYCNGSQITGSSNITVYRLPERVELAPLPPWQPVGQNFTLRCQVEDGSPRTSLTVVLLRWEEELSRQPAVEEPAEVTATVLASRDDHGAPFSCRTELDMQPQGLGLFVNTSAPRQLRTFVLPVTPPRLVAPRFLEVETSWPVDCTLDGLFPASEAQVY
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 3385

Enviar uma mensagem


ICAM3 (Human) Recombinant Protein

ICAM3 (Human) Recombinant Protein