GYPC (Human) Recombinant Protein
  • GYPC (Human) Recombinant Protein

GYPC (Human) Recombinant Protein

Ref: AB-H00002995-G01
GYPC (Human) Recombinant Protein

Información del producto

Human GYPC full-length ORF (NP_002092.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name GYPC
Gene Alias CD236|CD236R|GE|GPC|GYPD|MGC117309|MGC126191|MGC126192
Gene Description glycophorin C (Gerbich blood group)
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MWSTRSPNSTAWPLSLEPDPGMASASTTMHTTTIAEPDPGMSGWPDGRMETSTPTIMDIVVIAGVIAAVAIVLVSLLFVMLRYMYRHKGTYHTNEAKGTEFAESADAALQGDPALQDAGDSSRKEYFI
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 2995

Enviar uma mensagem


GYPC (Human) Recombinant Protein

GYPC (Human) Recombinant Protein