GRPR (Human) Recombinant Protein (P01)
  • GRPR (Human) Recombinant Protein (P01)

GRPR (Human) Recombinant Protein (P01)

Ref: AB-H00002925-P01
GRPR (Human) Recombinant Protein (P01)

Información del producto

Human GRPR full-length ORF ( NP_005305.1, 1 a.a. - 384 a.a.) recombinant protein with GST-tag at N-terminal.
Información adicional
Size 2 ug
Gene Name GRPR
Gene Alias -
Gene Description gastrin-releasing peptide receptor
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MALNDCFLLNLEVDHFMHCNISSHSADLPVNDDWSHPGILYVIPAVYGVIILIGLIGNITLIKIFCTVKSMRNVPNLFISSLALGDLLLLITCAPVDASRYLADRWLFGRIGCKLIPFIQLTSVGVSVFTLTALSADRYKAIVRPMDIQASHALMKICLKAAFIWIISMLLAIPEAVFSDLHPFHEESTNQTFISCAPYPHSNELHPKIHSMASFLVFYVIPLSIISVYYYFIAKNLIQSAYNLPVEGNIHVKKQ
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 2925

Enviar uma mensagem


GRPR (Human) Recombinant Protein (P01)

GRPR (Human) Recombinant Protein (P01)