View larger
Purified CXCL2 (NP_002080.1, 35 a.a. - 107 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in
AB-H00002920-H01
New product
CXCL2 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.
Data sheet
| Size | 2 ug |
| Gene Name | CXCL2 |
| Gene Alias | CINC-2a|GRO2|GROb|MGSA-b|MIP-2a|MIP2|MIP2A|SCYB2 |
| Gene Description | chemokine (C-X-C motif) ligand 2 |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Concentration | &ge |
| Application Key | WB,ELISA,SDS-PAGE,PI |
| Immunogen Prot. Seq | APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | SDS-PAGE |
| Storage Buffer | 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin. |
| Host | Human HEK293T cells |
| Gene ID | 2920 |
More info
Purified CXCL2 (NP_002080.1, 35 a.a. - 107 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.