GRM7 (Human) Recombinant Protein
  • GRM7 (Human) Recombinant Protein

GRM7 (Human) Recombinant Protein

Ref: AB-H00002917-G01
GRM7 (Human) Recombinant Protein

Información del producto

Human GRM7 full-length ORF (NP_000835.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name GRM7
Gene Alias FLJ40498|GLUR7|GPRC1G|MGLUR7|mGlu7
Gene Description glutamate receptor, metabotropic 7
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MVQLRKLLRVLTLMKFPCCVLEVLLCALAAAARGQEMYAPHSIRIEGDVTLGGLFPVHAKGPSGVPCGDIKRENGIHRLEAMLYALDQINSDPNLLPNVTLGARILDTCSRDTYALEQSLTFVQALIQKDTSDVRCTNGEPPVFVKPEKVVGVIGASGSSVSIMVANILRLFQIPQISYASTAPELSDDRRYDFFSRVVPPDSFQAQAMVDIVKALGWNYVSTLASEGSYGEKGVESFTQISKEAGGLCIAQSVR
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 2917

Enviar uma mensagem


GRM7 (Human) Recombinant Protein

GRM7 (Human) Recombinant Protein