GM2A (Human) Recombinant Protein
  • GM2A (Human) Recombinant Protein

GM2A (Human) Recombinant Protein

Ref: AB-H00002760-H01
GM2A (Human) Recombinant Protein

Información del producto

Purified GM2A (NP_000396.2 , 32 a.a. - 193 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
Información adicional
Size 25 ug
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Concentration >= 10 ug/ml
Application Key WB,ELISA,SDS-PAGE
Immunogen Prot. Seq SSFSWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI*
Form Liquid
Antigen species Target species Human
Quality control testing SDS-PAGE and Western Blot
Storage Buffer 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Host Human HEK293H cells

Enviar uma mensagem


GM2A (Human) Recombinant Protein

GM2A (Human) Recombinant Protein