GHSR (Human) Recombinant Protein View larger

Human GHSR full-length ORF (NP_004113.1) recombinant protein without tag.<br>This product is belong to Proteoliposome (PL).

AB-H00002693-G01

New product

GHSR (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 5 pontos de fidelização. Seu carrinho totalizará 5 pontos de fidelização que podem ser convertidos num vale de desconto de 20.00EUR.


Data sheet

Size 10 ug
Gene Name GHSR
Gene Alias -
Gene Description growth hormone secretagogue receptor
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAGNLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFVLVGVEHENGTDPWDTNECRPTEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLWRRRRGDAVVGASLRD
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 2693

More info

Human GHSR full-length ORF (NP_004113.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).

Enviar uma mensagem

Human GHSR full-length ORF (NP_004113.1) recombinant protein without tag.<br>This product is belong to Proteoliposome (PL).

Human GHSR full-length ORF (NP_004113.1) recombinant protein without tag.<br>This product is belong to Proteoliposome (PL).