FPR1 (Human) Recombinant Protein
  • FPR1 (Human) Recombinant Protein

FPR1 (Human) Recombinant Protein

Ref: AB-H00002357-G01
FPR1 (Human) Recombinant Protein

Información del producto

Human FPR1 full-length ORF (NP_002020.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name FPR1
Gene Alias FMLP|FPR
Gene Description formyl peptide receptor 1
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq METNSSLPTNISGGTPAVSAGYLFLDIITYLVFAVTFVLGVLGNGLVIWVAGFRMTHTVTTISYLNLAVADFCFTSTLPFFMVRKAMGGHWPFGWFLCKFVFTIVDINLFGSVFLIALIALDRCVCVLHPVWTQNHRTVSLAKKVIIGPWVMALLLTLPVIIRVTTVPGKTGTVACTFNFSPWTNDPKERINVAVAMLTVRGIIRFIIGFSAPMSIVAVSYGLIATKIHKQGLIKSSRPLRVLSFVAAAFFLCWS
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 2357

Enviar uma mensagem


FPR1 (Human) Recombinant Protein

FPR1 (Human) Recombinant Protein