FCGR2B (Human) Recombinant Protein
  • FCGR2B (Human) Recombinant Protein

FCGR2B (Human) Recombinant Protein

Ref: AB-H00002213-G01
FCGR2B (Human) Recombinant Protein

Información del producto

Human FCGR2B full-length ORF (NP_003992.3) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name FCGR2B
Gene Alias CD32|CD32B|FCG2|FCGR2|IGFR2
Gene Description Fc fragment of IgG, low affinity IIb, receptor (CD32)
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAAVVALIYCRKKRISAL
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 2213

Enviar uma mensagem


FCGR2B (Human) Recombinant Protein

FCGR2B (Human) Recombinant Protein