> >>>Human EPAS1 full-length ORF (NP_001421.2, 1 a.a. - 870 a.a.) recombinant protein with GST-tag at N-terminal.
EPAS1 (Human) Recombinant Protein (P03) View larger

Human EPAS1 full-length ORF (NP_001421.2, 1 a.a. - 870 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00002034-P03

New product

EPAS1 (Human) Recombinant Protein (P03)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Adicionar à Lista de desejos

Data sheet

Size 2 ug
Gene Name EPAS1
Gene Alias ECYT4|HIF2A|HLF|MOP2|PASD2|bHLHe73
Gene Description endothelial PAS domain protein 1
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MTADKEKKRSSSERRKEKSRDAARCRRSKETEVFYELAHELPLPHSVSSHLDKASIMRLAISFLRTHKLLSSVCSENESEAEADQQMDNLYLKALEGFIAVVTQDGDMIFLSENISKFMGLTQVELTGHSIFDFTHPCDHEEIRENLSLKNGSGFGKKSKDMSTERDFFMRMKCTVTNRGRTVNLKSATWKVLHCTGQVKVYNNCPPHNSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLDSKTFLSRHSMDMKFT
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 2034

More info

Human EPAS1 full-length ORF (NP_001421.2, 1 a.a. - 870 a.a.) recombinant protein with GST-tag at N-terminal.

Enviar uma mensagem

Human EPAS1 full-length ORF (NP_001421.2, 1 a.a. - 870 a.a.) recombinant protein with GST-tag at N-terminal.

Human EPAS1 full-length ORF (NP_001421.2, 1 a.a. - 870 a.a.) recombinant protein with GST-tag at N-terminal.