EDNRA (Human) Recombinant Protein
  • EDNRA (Human) Recombinant Protein

EDNRA (Human) Recombinant Protein

Ref: AB-H00001909-G01
EDNRA (Human) Recombinant Protein

Información del producto

Human EDNRA full-length ORF (ENSP00000315011) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name EDNRA
Gene Alias ETA|ETRA
Gene Description endothelin receptor type A
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVK
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 1909

Enviar uma mensagem


EDNRA (Human) Recombinant Protein

EDNRA (Human) Recombinant Protein