Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
EDN1 (Human) Recombinant Protein (P01)
Abnova
EDN1 (Human) Recombinant Protein (P01)
Ref: AB-H00001906-P01
EDN1 (Human) Recombinant Protein (P01)
Contacte-nos
Información del producto
Human EDN1 full-length ORF ( AAH09720.1, 1 a.a. - 212 a.a.) recombinant protein with GST-tag at N-terminal.
Información adicional
Size
2 ug
Gene Name
EDN1
Gene Alias
ET1|HDLCQ7
Gene Description
endothelin 1
Storage Conditions
Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key
ELISA,WB-Re,AP,Array
Immunogen Prot. Seq
MDYLLMIFSLLFVACQGAPETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGNPSRERYVTHNRAHW
Antigen species Target species
Human
Quality control testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID
1906
Enviar uma mensagem
EDN1 (Human) Recombinant Protein (P01)
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*