E4F1 (Human) Recombinant Protein (P01)
  • E4F1 (Human) Recombinant Protein (P01)

E4F1 (Human) Recombinant Protein (P01)

Ref: AB-H00001877-P01
E4F1 (Human) Recombinant Protein (P01)

Información del producto

Human E4F1 full-length ORF ( AAH80524.1, 1 a.a. - 784 a.a.) recombinant protein with GST-tag at N-terminal.
Información adicional
Size 2 ug
Gene Name E4F1
Gene Alias E4F|MGC99614
Gene Description E4F transcription factor 1
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MEGAMAVRVTAAHTAEAQAEAGREAGEGAVAAVAAALAPSGFLGLPAPFSEEDEDDVHRCGRCQAEFTALEDFVQHKIQKACQRAPPEALPATPATTALLGQEVVPAAPGPEEPITVAHIVVEAASLAADISHASDLVGGGHIKEVIVAAEAELGDGEMAEAPGSPHQQGLGLAGEGEQAQVKLLVNKDGRYVCALCHKTFKTGSILKAHMVTHSSRKDHECKLCGASFRTKGSLIRHHRRHTDERPYKCSKCGK
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 1877

Enviar uma mensagem


E4F1 (Human) Recombinant Protein (P01)

E4F1 (Human) Recombinant Protein (P01)