DRD2 (Human) Recombinant Protein
  • DRD2 (Human) Recombinant Protein

DRD2 (Human) Recombinant Protein

Ref: AB-H00001813-G01
DRD2 (Human) Recombinant Protein

Información del producto

Human DRD2 full-length ORF (ABM82846.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name DRD2
Gene Alias D2DR|D2R
Gene Description dopamine receptor D2
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTV
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 1813

Enviar uma mensagem


DRD2 (Human) Recombinant Protein

DRD2 (Human) Recombinant Protein