COX15 (Human) Recombinant Protein (P01)
  • COX15 (Human) Recombinant Protein (P01)

COX15 (Human) Recombinant Protein (P01)

Ref: AB-H00001355-P01
COX15 (Human) Recombinant Protein (P01)

Información del producto

Human COX15 full-length ORF ( AAH02382.1, 1 a.a. - 410 a.a.) recombinant protein with GST-tag at N-terminal.
Información adicional
Size 2 ug
Gene Name COX15
Gene Alias -
Gene Description COX15 homolog, cytochrome c oxidase assembly protein (yeast)
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MQRLLFPPLRALKGRQYLPLLAPRAAPRAQCDCIRRPLRPGQYSTISEVALQSGRGTVSLPSKAAERVVGRWLLVCSGTVAGAVILGGVTRLTESGLSMVDWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEYSHRMWGRLVGLVYILPAAYFWRKGWLSRGMKGRVLALCGLVCFQGLLGWYMVKSGLEEKSDSHDIPRVSQYRLAAHLGSALVLYCASLWTSLSLLLPPHKLPETH
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 1355

Enviar uma mensagem


COX15 (Human) Recombinant Protein (P01)

COX15 (Human) Recombinant Protein (P01)