COL3A1 (Human) Recombinant Protein (P02) View larger

Human COL3A1 full-length ORF ( AAH28178.1, 1 a.a. - 1163 a.a.) recombinant protein with GST-tag at N-terminal.

AB-H00001281-P02

New product

COL3A1 (Human) Recombinant Protein (P02)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 2 ug
Gene Name COL3A1
Gene Alias EDS4A|FLJ34534
Gene Description collagen, type III, alpha 1
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MMSFVQKGSWLLLALLHPTIILAQQEAVEGGCSHLGQSYADRDVWKPEPCQICVCDSGSVLCDDIICDDQELDCPNPEIPFGECCAVCPQPPTAPTRPPNGQGPQGPKGDPGPPGIPGRNGDPGIPGQPGSPGSPGPPGICESCPTGPQNYSPQYDSYDVKSGVAVGGLAGYPGPAGPPGPPGPPGTSGHPGSPGSPGYQGPPGEPGQAGPSGPPGPPGAIGPSGPAGKDGESGRPGRPGERGLPGPPGIKGPAG
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 1281

More info

Human COL3A1 full-length ORF ( AAH28178.1, 1 a.a. - 1163 a.a.) recombinant protein with GST-tag at N-terminal.

Enviar uma mensagem

Human COL3A1 full-length ORF ( AAH28178.1, 1 a.a. - 1163 a.a.) recombinant protein with GST-tag at N-terminal.

Human COL3A1 full-length ORF ( AAH28178.1, 1 a.a. - 1163 a.a.) recombinant protein with GST-tag at N-terminal.