CMKLR1 (Human) Recombinant Protein
  • CMKLR1 (Human) Recombinant Protein

CMKLR1 (Human) Recombinant Protein

Ref: AB-H00001240-G01
2 ug

Información del producto

CMKLR1 (Human) Recombinant Protein
Información adicional
Size 2 ug
Gene Name CMKLR1
Gene Alias CHEMERINR|ChemR23|DEZ|MGC126105|MGC126106
Gene Description chemokine-like receptor 1
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MEDEDYNTSISYGDEYPDYLDSIVVLEDLSPLEARVTRIFLVVVYSIVCFLGILGNGLVIIIATFKMKKTVNMVWFLNLAVADFLFNVFLPIHITYAAMDYHWVFGTAMCKISNFLLIHNMFTSVFLLTIISSDRCISVLLPVWSQNHRSVRLAYMACMVIWVLAFFLSSPSLVFRDTANLHGKISCFNNFSLSTPGSSSWPTHSQMDPVGYSRHMVVTVTRFLCGFLVPVLIITACYLTIVCKLQRNRLAKTKK
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 1240

Enviar uma mensagem


CMKLR1 (Human) Recombinant Protein

CMKLR1 (Human) Recombinant Protein