CCR7 (Human) Recombinant Protein
  • CCR7 (Human) Recombinant Protein

CCR7 (Human) Recombinant Protein

Ref: AB-H00001236-G01
2 ug

Información del producto

CCR7 (Human) Recombinant Protein
Información adicional
Size 2 ug
Gene Name CCR7
Gene Alias BLR2|CD197|CDw197|CMKBR7|EBI1
Gene Description chemokine (C-C motif) receptor 7
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWFLPIMYSIICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLLTLPFWAYSAAKSWVFGVHFCKLIFAIYKMSFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCVGIWILATVLSIPELLYSDLQRSSSEQAMRCSLITEHVEAFITIQVAQMVIGFLVPLLAMSFCYLVIIRTLLQARN
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 1236

Enviar uma mensagem


CCR7 (Human) Recombinant Protein

CCR7 (Human) Recombinant Protein