CCR3 (Human) Recombinant Protein
  • CCR3 (Human) Recombinant Protein

CCR3 (Human) Recombinant Protein

Ref: AB-H00001232-G01
CCR3 (Human) Recombinant Protein

Información del producto

Human CCR3 full-length ORF (NP_001828.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name CCR3
Gene Alias CC-CKR-3|CD193|CKR3|CMKBR3|MGC102841
Gene Description chemokine (C-C motif) receptor 3
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMAQFVPPLYSLVFTVGLLGNVVVVMILIKYRRLRIMTNIYLLNLAISDLLFLVTLPFWIHYVRGHNWVFGHGMCKLLSGFYHTGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIVTWGLAVLAALPEFIFYETEELFEETLCSALYPEDTVYSWRHFHTLRMTIFCLVLPLLVMAICYTGIIKTLLRCPSKKKYKAIRLIFVIMAVFFIFWTPY
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 1232

Enviar uma mensagem


CCR3 (Human) Recombinant Protein

CCR3 (Human) Recombinant Protein