AP2M1 (Human) Recombinant Protein (P01)
  • AP2M1 (Human) Recombinant Protein (P01)

AP2M1 (Human) Recombinant Protein (P01)

Ref: AB-H00001173-P01
AP2M1 (Human) Recombinant Protein (P01)

Información del producto

Human AP2M1 full-length ORF ( NP_004059.2, 1 a.a. - 435 a.a.) recombinant protein with GST-tag at N-terminal.
Información adicional
Size 2 ug
Gene Name AP2M1
Gene Alias AP50|CLAPM1|mu2
Gene Description adaptor-related protein complex 2, mu 1 subunit
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTKQNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLIYELLDEILDFGYPQNSETGALKTFITQQGIKSQHQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADETSKSGKQSIAIDDCTFHQCVRLS
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 1173

Enviar uma mensagem


AP2M1 (Human) Recombinant Protein (P01)

AP2M1 (Human) Recombinant Protein (P01)