CHRM2 (Human) Recombinant Protein
  • CHRM2 (Human) Recombinant Protein

CHRM2 (Human) Recombinant Protein

Ref: AB-H00001129-G01
CHRM2 (Human) Recombinant Protein

Información del producto

Human CHRM2 full-length ORF (AAI06743.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name CHRM2
Gene Alias FLJ43243|HM2|MGC120006|MGC120007
Gene Description cholinergic receptor, muscarinic 2
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MNNSTNSSNNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNYFLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFDRYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQFFSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKDKKEPVANQDPVSPSLVQGRIVKPNNNNMPSSDDGL
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 1129

Enviar uma mensagem


CHRM2 (Human) Recombinant Protein

CHRM2 (Human) Recombinant Protein