CHRM1 (Human) Recombinant Protein
  • CHRM1 (Human) Recombinant Protein

CHRM1 (Human) Recombinant Protein

Ref: AB-H00001128-G01
CHRM1 (Human) Recombinant Protein

Información del producto

Human CHRM1 full-length ORF (NP_000729.2) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name CHRM1
Gene Alias HM1|M1|MGC30125
Gene Description cholinergic receptor, muscarinic 1
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVNNYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLISFDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYIQFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSSSERSQPGAEGSPETP
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 1128

Enviar uma mensagem


CHRM1 (Human) Recombinant Protein

CHRM1 (Human) Recombinant Protein