CD74 (Human) Recombinant Protein View larger

Human CD74 full-length ORF (NP_001020329.1) recombinant protein without tag.<br>This product is belong to Proteoliposome (PL).

AB-H00000972-G01

New product

CD74 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 5 pontos de fidelização. Seu carrinho totalizará 5 pontos de fidelização que podem ser convertidos num vale de desconto de 20.00EUR.


Data sheet

Size 10 ug
Gene Name CD74
Gene Alias DHLAG|HLADG|Ia-GAMMA
Gene Description CD74 molecule, major histocompatibility complex, class II invariant chain
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQSHWNWRTRLLGWV
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 972

More info

Human CD74 full-length ORF (NP_001020329.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).

Enviar uma mensagem

Human CD74 full-length ORF (NP_001020329.1) recombinant protein without tag.<br>This product is belong to Proteoliposome (PL).

Human CD74 full-length ORF (NP_001020329.1) recombinant protein without tag.<br>This product is belong to Proteoliposome (PL).