CD70 (Human) Recombinant Protein
  • CD70 (Human) Recombinant Protein

CD70 (Human) Recombinant Protein

Ref: AB-H00000970-G01
10 ug

Información del producto

CD70 (Human) Recombinant Protein
Información adicional
Size 10 ug
Gene Name CD70
Gene Alias CD27L|CD27LG|TNFSF7
Gene Description CD70 molecule
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 970

Enviar uma mensagem


CD70 (Human) Recombinant Protein

CD70 (Human) Recombinant Protein