CD40 (Human) Recombinant Protein
  • CD40 (Human) Recombinant Protein

CD40 (Human) Recombinant Protein

Ref: AB-H00000958-H02
CD40 (Human) Recombinant Protein

Información del producto

Purified CD40 (AAH12419.1 , 21 a.a. - 193 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
Información adicional
Size 25 ug
Gene Name CD40
Gene Alias Bp50|CDW40|MGC9013|TNFRSF5|p50
Gene Description CD40 molecule, TNF receptor superfamily member 5
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Concentration &ge
Application Key WB,ELISA,SDS-PAGE,PI
Immunogen Prot. Seq EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR
Form Liquid
Antigen species Target species Human
Quality control testing SDS-PAGE and Western Blot
Storage Buffer 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Host Human HEK293H cells
Gene ID 958

Enviar uma mensagem


CD40 (Human) Recombinant Protein

CD40 (Human) Recombinant Protein