SCARB1 (Human) Recombinant Protein (P01)
  • SCARB1 (Human) Recombinant Protein (P01)

SCARB1 (Human) Recombinant Protein (P01)

Ref: AB-H00000949-P01
SCARB1 (Human) Recombinant Protein (P01)

Información del producto

Human SCARB1 full-length ORF ( Q8WTV0, 1 a.a. - 552 a.a.) recombinant protein with GST-tag at N-terminal.
Información adicional
Size 2 ug
Gene Name SCARB1
Gene Alias CD36L1|CLA-1|CLA1|MGC138242|SR-BI|SRB1
Gene Description scavenger receptor class B, member 1
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLKNVRIDPSSLSFNMWKEIPIPFYLSVYFFDVMNPSEILKGEKPQVRERGPYVYREFRHKSNITFNNNDTVSFLEYRTFQFQPSKSHGSESDYIVMPNILVLGAAVMMENKPMTLKLIMTLAFTTLGERAFMNRTVGEIMWGYKDPLVNLINKYFPGMFPFKDKFGLFAELNNSDSGLFTVFTGVQNISRIHLVDKWNGLSKVDFWHSDQCNMIN
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 949

Enviar uma mensagem


SCARB1 (Human) Recombinant Protein (P01)

SCARB1 (Human) Recombinant Protein (P01)