CD86 (Human) Recombinant Protein
  • CD86 (Human) Recombinant Protein

CD86 (Human) Recombinant Protein

Ref: AB-H00000942-G01
CD86 (Human) Recombinant Protein

Información del producto

Human CD86 full-length ORF (AAH40261.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name CD86
Gene Alias B7-2|B70|CD28LG2|LAB72|MGC34413
Gene Description CD86 molecule
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MDPQCTMGLSNILFVMAFLLSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGIMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIPWITAVLPT
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 942

Enviar uma mensagem


CD86 (Human) Recombinant Protein

CD86 (Human) Recombinant Protein