CD28 (Human) Recombinant Protein
  • CD28 (Human) Recombinant Protein

CD28 (Human) Recombinant Protein

Ref: AB-H00000940-G01
CD28 (Human) Recombinant Protein

Información del producto

Human CD28 full-length ORF (AAH93698.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name CD28
Gene Alias MGC138290|Tp44
Gene Description CD28 molecule
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 940

Enviar uma mensagem


CD28 (Human) Recombinant Protein

CD28 (Human) Recombinant Protein