CD8A (Human) Recombinant Protein
  • CD8A (Human) Recombinant Protein

CD8A (Human) Recombinant Protein

Ref: AB-H00000925-G01
10 ug

Información del producto

CD8A (Human) Recombinant Protein
Información adicional
Size 10 ug
Gene Name CD8A
Gene Alias CD8|Leu2|MAL|p32
Gene Description CD8a molecule
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGCYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 925

Enviar uma mensagem


CD8A (Human) Recombinant Protein

CD8A (Human) Recombinant Protein