CD3D (Human) Recombinant Protein
  • CD3D (Human) Recombinant Protein

CD3D (Human) Recombinant Protein

Ref: AB-H00000915-G01
CD3D (Human) Recombinant Protein

Información del producto

Human CD3D full-length ORF (NP_000723.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name CD3D
Gene Alias CD3-DELTA|T3D
Gene Description CD3d molecule, delta (CD3-TCR complex)
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 915

Enviar uma mensagem


CD3D (Human) Recombinant Protein

CD3D (Human) Recombinant Protein